Atlas Antibodies Anti-SPATA6L Antibody

상품 한눈에 보기

Human SPATA6L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증 완료. Affinity purification 방식으로 정제되었으며, 인간 시료에 적합. spermatogenesis 관련 단백질 연구에 유용.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039585-100 Anti-SPATA6L Antibody, spermatogenesis associated 6-like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039585-25 Anti-SPATA6L Antibody, spermatogenesis associated 6-like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

spermatogenesis associated 6-like

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human SPATA6L.

C9orf68, FLJ10058

항목	내용
Target Protein	spermatogenesis associated 6-like
Target Gene	SPATA6L
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	FATYQHSTSPGPLDQPLLRERFHPGSQSTWKNIHERVCSLLTSHRAQLHQNKEDSTSEVNYIIERPSYPLKKYSLHE

Human

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000064202	58%
Rat	ENSRNOG00000015137	56%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand