CacheBy
Atlas Antibodies Anti-SPATA9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPATA9 Antibody

상품 한눈에 보기

Human SPATA9 단백질을 타깃으로 하는 폴리클로날 토끼 항체입니다. IHC, WB(재조합 발현), ICC에 사용 가능합니다. PrEST 항원을 이용해 친화 정제되었으며, 인체 반응성이 검증되었습니다. 생식세포 관련 연구에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010848-100 Anti-SPATA9 Antibody, spermatogenesis associated 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010848-25 Anti-SPATA9 Antibody, spermatogenesis associated 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPATA9 Antibody

Anti-SPATA9 Antibody

Target: Spermatogenesis associated 9 (SPATA9)
Type: Polyclonal antibody against human SPATA9
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, recombinant expression validation)
  • ICC (Immunocytochemistry)

Validation: Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against Human SPATA9.


Alternative Gene Names

FLJ35906, NYD-SP16

Open Datasheet


Target Information

항목 내용
Target Protein Spermatogenesis associated 9
Target Gene SPATA9
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (81%), Mouse (77%)

Antigen Sequence:
LKKVKNIFQEEESIRQNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVLHSVFDQSAEMNEQI


Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.