
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SMARCD3 Antibody
상품 한눈에 보기
인간 SMARCD3 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 사용해 높은 특이성과 재현성 확보. 인간에 반응하며 마우스와 100% 서열 동일성 보유.
- 카탈로그번호
- HPA063955-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA063955-100 Anti-SMARCD3 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063955-25 Anti-SMARCD3 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SMARCD3 Antibody
Anti-SMARCD3 Antibody
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human SMARCD3
Alternative Gene Names
BAF60C, CRACD3, Rsc6p
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 |
| Target Gene | SMARCD3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DEVAGGARKATKSKLFEFLVHGVRPGMPSGARMPHQGAPMGPPGSPYMGSPA |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000028949 (100%) Rat ENSRNOG00000010077 (56%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



