CacheBy
Atlas Antibodies Anti-SMARCD3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SMARCD3 Antibody

상품 한눈에 보기

인간 SMARCD3 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 사용해 높은 특이성과 재현성 확보. 인간에 반응하며 마우스와 100% 서열 동일성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA063955-100 Anti-SMARCD3 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063955-25 Anti-SMARCD3 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SMARCD3 Antibody

Anti-SMARCD3 Antibody

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3

  • IHC (Immunohistochemistry)
  • WB (Western Blot) — Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human SMARCD3

Alternative Gene Names

BAF60C, CRACD3, Rsc6p

Open Datasheet

Target Information

항목 내용
Target Protein SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Target Gene SMARCD3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
DEVAGGARKATKSKLFEFLVHGVRPGMPSGARMPHQGAPMGPPGSPYMGSPA
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000028949 (100%)
Rat ENSRNOG00000010077 (56%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.