Atlas Antibodies Anti-SMARCD2 Antibody

상품 한눈에 보기

인간 SMARCD2 단백질을 인식하는 폴리클로날 항체로, SWI/SNF 크로마틴 조절 복합체 연구에 적합합니다. 토끼 유래 IgG 형식이며, 높은 종간 항원 서열 일치율을 보입니다. 프레스티지 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

카탈로그번호: HPA061348-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA061348-100 Anti-SMARCD2 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA061348-25 Anti-SMARCD2 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SMARCD2 Antibody

Anti-SMARCD2 Antibody

Target: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2

Recommended Applications

면역세포화학(ICC) 등 다양한 연구용 응용에 적합

Product Description

Polyclonal Antibody against Human SMARCD2

Alternative Gene Names

BAF60B, CRACD2, PRO2451, Rsc6p

Open Datasheet

Target Information

Target Protein: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Target Gene: SMARCD2
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
RIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELR
```

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000078619 (92%)
Rat ENSRNOG00000010557 (90%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.