Atlas Antibodies Anti-SMARCD2 Antibody
| 상품 옵션 정보 | |||||||
|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA061348-100 | Atlas Antibodies HPA061348-100 Anti-SMARCD2 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA061348-25 | Atlas Antibodies HPA061348-25 Anti-SMARCD2 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-SMARCD2 Antibody
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Recommended Applications
Product Description
Polyclonal Antibody against Human SMARCD2
Alternative Gene Names
BAF60B, CRACD2, PRO2451, Rsc6p
Target Protein
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Target Gene
SMARCD2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
RIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELR
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000078619 (92%)
Rat ENSRNOG00000010557 (90%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|