Atlas Antibodies Anti-SMARCD2 Antibody

상품 한눈에 보기

인간 SMARCD2 단백질을 인식하는 폴리클로날 항체. SWI/SNF 크로마틴 리모델링 복합체 연구에 적합. 토끼 유래 IgG 형식으로 높은 특이성과 재현성 제공. 프레스티지 항원 기반 친화 정제 방식으로 고순도 확보.

카탈로그번호: HPA059934-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA059934-100 Anti-SMARCD2 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA059934-25 Anti-SMARCD2 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SMARCD2 Antibody

Anti-SMARCD2 Antibody

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2

Recommended Applications

면역세포화학(ICC) 등 다양한 응용 분야에 사용 가능

Product Description

Polyclonal Antibody against Human SMARCD2

Alternative Gene Names

BAF60B, CRACD2, PRO2451, Rsc6p

Open Datasheet

Target Information

Target Protein: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Target Gene: SMARCD2
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
RIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELR
```

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000078619	92%
Rat	ENSRNOG00000010557	90%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand