Atlas Antibodies Anti-SMARCD1 Antibody

상품 한눈에 보기

Human SMARCD1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. BAF60A/CRACD1 등 대체 유전자명으로도 알려져 있으며, PrEST 항원을 이용해 친화 정제되었습니다. 사람, 생쥐, 랫드에 반응합니다.

카탈로그번호: HPA004101-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA004101-100 Anti-SMARCD1 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA004101-25 Anti-SMARCD1 Antibody, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SMARCD1 Antibody

Anti-SMARCD1 Antibody

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SMARCD1.

Alternative Gene Names

BAF60A, CRACD1, Rsc6p

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
Target Gene	SMARCD1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKK

Species Reactivity

Human
Mouse
Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000061572 (100%)
Mouse ENSMUSG00000023018 (100%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) containing 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand