Thermo Fisher Scientific SOD3 Polyclonal Antibody
Human SOD3 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC(P), ICC/IF에 사용 가능. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 재현성을 보장. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도 유지.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.25–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human SOD3 (WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747165 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. It is widely expressed in human tissues and shows increased expression in actively dividing cells such as testis, thymus, fetal liver, and carcinomas. The protein localizes to the nucleus and promotes stability and nuclear accumulation of transcriptionally active p53, phosphorylates Thr18 of p53, and reduces p53 ubiquitination. It may regulate cell proliferation and also phosphorylates histone, casein, and transcription factors ATF2 and c-JUN.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SOD2 (MnSOD) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SNRPN Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SOD3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SMC6 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SNRPN Polyclonal Antibody
668,200원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|