Thermo Fisher Scientific SOD2 (MnSOD) Polyclonal Antibody
Thermo Fisher Scientific의 SOD2 (MnSOD) Polyclonal Antibody는 인간, 마우스, 랫트 반응성을 가지며 Western blot, IHC, ICC/IF에 사용 가능합니다. 항원 친화 크로마토그래피로 정제된 비결합 항체로, 미토콘드리아 내 MnSOD 단백질 검출에 적합합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human SOD2 (192–222 aa, QYKNVRPDYLKAIWNVINWENVTERYMACKK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747164 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Superoxide dismutase (SOD) is an antioxidant enzyme that protects cells against reactive oxygen species (ROS). It catalyzes the conversion of superoxide radicals (O₂⁻) into hydrogen peroxide, which is further reduced to water and oxygen by glutathione peroxidase and catalase.
There are several classes of SOD:
- SOD1 (Cu/Zn-SOD): Cytoplasmic enzyme, 32 kDa homodimer, containing Cu and Zn ions.
- SOD2 (Mn-SOD): Mitochondrial enzyme, 80 kDa tetramer, located in the mitochondrial matrix near the respiratory chain.
- SOD3 (EC-SOD): Extracellular enzyme, multimeric form expressed in lungs, vessel walls, and airways.
- SOD4 (CCS): Copper chaperone for SOD1, delivers Cu cofactor and activates Cu/Zn-SOD.
Usage Note
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SOX10 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SOD3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SOD2 (MnSOD) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SNRPN Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SOD3 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|