원본
Thermo Fisher Scientific SOD2 (MnSOD) Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 SOD2 (MnSOD) Polyclonal Antibody는 인간, 마우스, 랫트 반응성을 가지며 Western blot, IHC, ICC/IF에 사용 가능합니다. 항원 친화 크로마토그래피로 정제된 비결합 항체로, 미토콘드리아 내 MnSOD 단백질 검출에 적합합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 09:24
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA580049 SOD2 (MnSOD) Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific SOD2 (MnSOD) Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human SOD2 (192–222 aa, QYKNVRPDYLKAIWNVINWENVTERYMACKK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747164 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Superoxide dismutase (SOD) is an antioxidant enzyme that protects cells against reactive oxygen species (ROS). It catalyzes the conversion of superoxide radicals (O₂⁻) into hydrogen peroxide, which is further reduced to water and oxygen by glutathione peroxidase and catalase.
There are several classes of SOD:
- SOD1 (Cu/Zn-SOD): Cytoplasmic enzyme, 32 kDa homodimer, containing Cu and Zn ions.
- SOD2 (Mn-SOD): Mitochondrial enzyme, 80 kDa tetramer, located in the mitochondrial matrix near the respiratory chain.
- SOD3 (EC-SOD): Extracellular enzyme, multimeric form expressed in lungs, vessel walls, and airways.
- SOD4 (CCS): Copper chaperone for SOD1, delivers Cu cofactor and activates Cu/Zn-SOD.
Usage Note
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific SOX10 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SOD3 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SNRPN Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SOD3 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.