Thermo Fisher Scientific CCL1 Polyclonal Antibody, PeproTech

Applications and Tested Dilutions

Product Specifications

Product Specific Information

AA Sequence of recombinant protein:
SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEA CALDTVGWVQRHRKMLRHCPSKRK

Preparation:
Produced from sera of rabbits immunized with highly pure Recombinant Human I-309 (CCL1). Anti-Human I-309 (CCL1)-specific antibody was purified by affinity chromatography employing an immobilized Human I-309 (CCL1) matrix.

Sandwich ELISA:
To detect Human I-309 (CCL1) by sandwich ELISA (using 100 µL/well antibody solution), a concentration of 0.5–2.0 µg/mL of this antibody is required. This antigen affinity purified antibody, in conjunction with PeproTech Biotinylated Anti-Human I-309 (CCL1) (500-P110Bt) as a detection antibody, allows detection of at least 0.2–0.4 ng/well of Recombinant Human I-309 (CCL1).

Western Blot:
To detect Human I-309 (CCL1) by Western blot analysis, this antibody can be used at a concentration of 0.1–0.2 µg/mL. When used with compatible secondary reagents, the detection limit for Recombinant Human I-309 (CCL1) is 1.5–3.0 ng/lane, under either reducing or non-reducing conditions.

Target Information

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are secreted proteins involved in immunoregulatory and inflammatory processes. The encoded protein is structurally related to the CXC subfamily of cytokines, characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.