Thermo Fisher Scientific CCL1 Polyclonal Antibody, PeproTech
Human CCL1 (I-309)을 인식하는 Rabbit Polyclonal Antibody로, Western blot, ELISA, Immunostaining 등에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, Lyophilized 형태로 제공. 인체 유래 시토카인 연구용에 적합.
- 카탈로그번호
- 500-P110-xxx (3개 옵션)
- 판매단위
- pk
카탈로그
3개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CCL1 Polyclonal Antibody, PeproTech
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.2 µg/mL | – |
| ELISA (ELISA) | 0.5–2.0 µg/mL | 2 publications |
| In vitro Assay (IV) | – | 1 publication |
| Immunostaining (IS) | – | 1 publication |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Published Species | Human |
| Host / Isotype | Rabbit |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | E.coli-derived Recombinant Human I-309 (CCL1) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.1–1.0 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient |
| RRID | AB_2929249 |
Product Specific Information
AA Sequence of recombinant protein:
SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEA CALDTVGWVQRHRKMLRHCPSKRK
Preparation:
Produced from sera of rabbits immunized with highly pure Recombinant Human I-309 (CCL1). Anti-Human I-309 (CCL1)-specific antibody was purified by affinity chromatography employing an immobilized Human I-309 (CCL1) matrix.
Sandwich ELISA:
To detect Human I-309 (CCL1) by sandwich ELISA (using 100 µL/well antibody solution), a concentration of 0.5–2.0 µg/mL of this antibody is required. This antigen affinity purified antibody, in conjunction with PeproTech Biotinylated Anti-Human I-309 (CCL1) (500-P110Bt) as a detection antibody, allows detection of at least 0.2–0.4 ng/well of Recombinant Human I-309 (CCL1).
Western Blot:
To detect Human I-309 (CCL1) by Western blot analysis, this antibody can be used at a concentration of 0.1–0.2 µg/mL. When used with compatible secondary reagents, the detection limit for Recombinant Human I-309 (CCL1) is 1.5–3.0 ng/lane, under either reducing or non-reducing conditions.
Target Information
This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are secreted proteins involved in immunoregulatory and inflammatory processes. The encoded protein is structurally related to the CXC subfamily of cytokines, characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.