Atlas Antibodies Anti-EXOC6 Antibody
상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA059111-100 | - | Atlas Antibodies HPA059111-100 Anti-EXOC6 Antibody, exocyst complex component 6 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA059111-25 | - | Atlas Antibodies HPA059111-25 Anti-EXOC6 Antibody, exocyst complex component 6 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-EXOC6 Antibody
exocyst complex component 6
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human EXOC6
Alternative Gene Names
DKFZp761I2124, EXOC6A, FLJ1125, MGC33397, SEC15L, SEC15L1, Sec15p
Target Protein
exocyst complex component 6
Target Gene
EXOC6
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000053799 (63%)
Rat ENSRNOG00000036601 (56%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|