
Atlas Antibodies Anti-EXOC6 Antibody
상품 한눈에 보기
Human EXOC6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 검증 완료. Recombinant expression 기반 검증으로 높은 특이성과 재현성 제공. Affinity purification으로 높은 순도 확보. 다양한 연구 응용에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-EXOC6 Antibody
Target: exocyst complex component 6
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant expression validation)
- Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human EXOC6
Alternative Gene Names
DKFZp761I2124, EXOC6A, FLJ1125, MGC33397, SEC15L, SEC15L1, Sec15p
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | exocyst complex component 6 |
| Target Gene | EXOC6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE |
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000053799 | 63% |
| Rat | ENSRNOG00000036601 | 56% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-EXOC6B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EXOC6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EXOC6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EXOC4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EXOC5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.