CacheBy
Atlas Antibodies Anti-EXOC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EXOC4 Antibody

상품 한눈에 보기

Human EXOC4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 주요 대체 유전자명: SEC8, KIAA1699.

카탈로그번호
HPA031443-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031443-100 Anti-EXOC4 Antibody, exocyst complex component 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031443-25 Anti-EXOC4 Antibody, exocyst complex component 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EXOC4 Antibody

Anti-EXOC4 Antibody

Target Information

  • Protein: Exocyst complex component 4
  • Gene: EXOC4
  • Alternative Gene Names: KIAA1699, MGC27170, SEC8, SEC8L1, Sec8p
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human EXOC4.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QHKFQYIFEGLGHLISCILINGAQYFRRISESGIKKMCRNIFVLQQNLTNITMSREADLDFARQYYEMLYNTADELLNLVVDQGVKYTELEYIHALTLLHRSQTGVGELTTQNTRLQRLKEIICEQAAIKQATKD

Species Reactivity

  • Verified Species: Human
  • Orthologs with High Identity:
    • Mouse (ENSMUSG00000029763) — 99%
    • Rat (ENSRNOG00000046023) — 99%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.