
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EXOC6 Antibody
상품 한눈에 보기
Atlas Antibodies의 Anti-EXOC6 Rabbit Polyclonal Antibody는 인간 EXOC6 단백질을 인식하며, IHC 및 WB(재조합 발현) 검증에 적합합니다. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다. Human 반응성 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036285-100 Anti-EXOC6 Antibody, exocyst complex component 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036285-25 Anti-EXOC6 Antibody, exocyst complex component 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EXOC6 Antibody
Anti-EXOC6 Antibody
exocyst complex component 6
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal Antibody against Human EXOC6
Alternative Gene Names
DKFZp761I2124, EXOC6A, FLJ1125, MGC33397, SEC15L, SEC15L1, Sec15p
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | exocyst complex component 6 |
| Target Gene | EXOC6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000053799 (63%) Rat ENSRNOG00000036601 (56%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



