CacheBy
Atlas Antibodies Anti-EXOC5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EXOC5 Antibody

상품 한눈에 보기

Human EXOC5 단백질을 인식하는 Rabbit Polyclonal 항체로, exocyst complex component 5 연구에 적합합니다. SEC10, SEC10L1, SEC10P 대체 유전자명 사용 가능하며, Affinity purification 방식으로 정제되었습니다. IHC 등 다양한 응용에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060837-100 Anti-EXOC5 Antibody, exocyst complex component 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060837-25 Anti-EXOC5 Antibody, exocyst complex component 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EXOC5 Antibody

Anti-EXOC5 Antibody

Target Information

  • Target Protein: exocyst complex component 5
  • Target Gene: EXOC5
  • Alternative Gene Names: SEC10, SEC10L1, SEC10P

Product Description

Polyclonal antibody against Human EXOC5.

면역조직화학 (IHC) 등 다양한 응용에 적합합니다.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TVLAKLIQNVFEIKLQSFVKEQLEECRKSDAEQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat: ENSRNOG00000013804 (92%)
  • Mouse: ENSMUSG00000061244 (92%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.