
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC25A24 Antibody
상품 한눈에 보기
Human SLC25A24 단백질을 타깃하는 고품질 Rabbit Polyclonal 항체. WB 및 ICC 검증 완료. PrEST 항원 기반 친화 정제. 인간에 높은 특이성과 재현성 보유. 연구용 단백질 발현 분석에 적합.
- 카탈로그번호
- HPA063636-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA063636-100 Anti-SLC25A24 Antibody, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063636-25 Anti-SLC25A24 Antibody, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC25A24 Antibody
Anti-SLC25A24 Antibody
solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
Recommended Applications
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein
- ICC (Immunocytochemistry): Verified for cellular localization studies
Product Description
Polyclonal Antibody against Human SLC25A24
Alternative Gene Names
- APC1
- DKFZp586G0123
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 |
| Target Gene | SLC25A24 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (95%), Rat (93%) |
Antigen Sequence:
SLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAK
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Open Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



