CacheBy
Atlas Antibodies Anti-SLC25A24 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A24 Antibody

상품 한눈에 보기

Human SLC25A24 단백질을 타깃하는 고품질 Rabbit Polyclonal 항체. WB 및 ICC 검증 완료. PrEST 항원 기반 친화 정제. 인간에 높은 특이성과 재현성 보유. 연구용 단백질 발현 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA063636-100 Anti-SLC25A24 Antibody, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063636-25 Anti-SLC25A24 Antibody, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A24 Antibody

Anti-SLC25A24 Antibody

solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24


  • WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein
  • ICC (Immunocytochemistry): Verified for cellular localization studies

Product Description

Polyclonal Antibody against Human SLC25A24


Alternative Gene Names

  • APC1
  • DKFZp586G0123

Target Information

항목 내용
Target Protein solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
Target Gene SLC25A24
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (95%), Rat (93%)

Antigen Sequence:
SLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAK


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet

제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.