CacheBy
Atlas Antibodies Anti-SLC25A24 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A24 Antibody

상품 한눈에 보기

Human SLC25A24 단백질을 타깃하는 고품질 Rabbit Polyclonal 항체. WB 및 ICC 검증 완료. PrEST 항원 기반 친화 정제. 인간에 높은 특이성과 재현성 보유. 연구용 단백질 발현 분석에 적합.

카탈로그번호
HPA063636-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063636-100 Anti-SLC25A24 Antibody, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063636-25 Anti-SLC25A24 Antibody, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A24 Antibody

Anti-SLC25A24 Antibody

solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24


  • WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein
  • ICC (Immunocytochemistry): Verified for cellular localization studies

Product Description

Polyclonal Antibody against Human SLC25A24


Alternative Gene Names

  • APC1
  • DKFZp586G0123

Target Information

항목 내용
Target Protein solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
Target Gene SLC25A24
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (95%), Rat (93%)

Antigen Sequence:
SLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAK


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet

제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.