
Atlas Antibodies Anti-SLC25A20 Antibody
상품 한눈에 보기
Human SLC25A20 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 WB 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인간 시료에 적합하며, 보존용으로 sodium azide가 포함됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC25A20 Antibody
Solute carrier family 25 (carnitine/acylcarnitine translocase), member 20
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human SLC25A20
Alternative Gene Names
- CAC
- CACT
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 |
| Target Gene | SLC25A20 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYR |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000020288 (98%), Mouse ENSMUSG00000032602 (93%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC25A24 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC25A24 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC25A20 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC25A23 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC25A22 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.