CacheBy
Atlas Antibodies Anti-SLC25A27 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A27 Antibody

상품 한눈에 보기

인간 SLC25A27 단백질을 인식하는 토끼 폴리클로날 항체. PrEST 항원을 이용해 친화 정제됨. 면역형광(ICC) 등 다양한 응용에 적합. 인간 반응성이 검증되었으며, 마우스 및 랫과 높은 서열 유사성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA069732-100 Anti-SLC25A27 Antibody, solute carrier family 25, member 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069732-25 Anti-SLC25A27 Antibody, solute carrier family 25, member 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A27 Antibody

Anti-SLC25A27 Antibody

Target: solute carrier family 25, member 27 (SLC25A27)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human SLC25A27.

Alternative Gene Names

FLJ33552, UCP4

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    MQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000023912 (89%)
  • Rat ENSRNOG00000010592 (86%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


  • Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.