CacheBy
Atlas Antibodies Anti-SLC25A24 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A24 Antibody

상품 한눈에 보기

Human SLC25A24 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 사람에 대해 검증되었습니다. 40% 글리세롤과 PBS 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA028519-100 Anti-SLC25A24 Antibody, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028519-25 Anti-SLC25A24 Antibody, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A24 Antibody

Anti-SLC25A24 Antibody

Target: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
Supplier: Atlas Antibodies


  • WB (Western Blot): Independent antibody validation — 단백질 발현을 서로 다른 에피토프를 인식하는 항체로 비교 검증
  • ICC (Immunocytochemistry): 세포 수준의 단백질 발현 분석에 적합

Product Description

Polyclonal antibody against Human SLC25A24.


Alternative Gene Names

APC1, DKFZp586G0123

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
Target Gene SLC25A24
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence (Amino Acids) SLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAK
Verified Species Reactivity Human
Interspecies Identity Mouse (95%), Rat (93%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Info Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.