CacheBy
Atlas Antibodies Anti-SLC25A22 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC25A22 Antibody

상품 한눈에 보기

Human SLC25A22 단백질에 대한 폴리클로날 토끼 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 사용해 친화 정제되었으며, 사람, 마우스, 랫트에 반응합니다. 40% 글리세롤/PBS 버퍼에 보존제로 나트륨 아지드가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA014662-100 Anti-SLC25A22 Antibody, solute carrier family 25 (mitochondrial carrier: glutamate), member 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014662-25 Anti-SLC25A22 Antibody, solute carrier family 25 (mitochondrial carrier: glutamate), member 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC25A22 Antibody

Anti-SLC25A22 Antibody

Target: solute carrier family 25 (mitochondrial carrier: glutamate), member 22
Product Type: Polyclonal Antibody against Human SLC25A22


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human SLC25A22.


Alternative Gene Names

EIEE3, FLJ13044, GC1, NET44

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 25 (mitochondrial carrier: glutamate), member 22
Target Gene SLC25A22
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVE

Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000019082 (98%)
  • Rat ENSRNOG00000018450 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.