
Atlas Antibodies Anti-SLC12A7 Antibody
상품 한눈에 보기
Human SLC12A7 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. Mouse와 Rat에서도 교차 반응 가능. PrEST 항원을 사용해 친화 정제됨. 40% glycerol, PBS buffer에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC12A7 Antibody
Target: solute carrier family 12 (potassium/chloride transporter), member 7
Product Type: Polyclonal Antibody against Human SLC12A7
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody raised in rabbit against human SLC12A7 (solute carrier family 12, potassium/chloride transporter, member 7).
Alternative Gene Names
- DKFZP434F076
- KCC4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 12 (potassium/chloride transporter), member 7 |
| Target Gene | SLC12A7 |
| Antigen Sequence | AARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNV |
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse (84%), Rat (82%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 실험자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC12A6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC13A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC12A7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC12A4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC12A5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.