CacheBy
Atlas Antibodies Anti-SLC12A7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC12A7 Antibody

상품 한눈에 보기

Human SLC12A7 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. Mouse와 Rat에서도 교차 반응 가능. PrEST 항원을 사용해 친화 정제됨. 40% glycerol, PBS buffer에 보존.

카탈로그번호
HPA041652-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041652-100 Anti-SLC12A7 Antibody, solute carrier family 12 (potassium/chloride transporter), member 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041652-25 Anti-SLC12A7 Antibody, solute carrier family 12 (potassium/chloride transporter), member 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC12A7 Antibody

Anti-SLC12A7 Antibody

Target: solute carrier family 12 (potassium/chloride transporter), member 7
Product Type: Polyclonal Antibody against Human SLC12A7


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human SLC12A7 (solute carrier family 12, potassium/chloride transporter, member 7).


Alternative Gene Names

  • DKFZP434F076
  • KCC4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 12 (potassium/chloride transporter), member 7
Target Gene SLC12A7
Antigen Sequence AARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNV
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse (84%), Rat (82%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 실험자가 직접 결정해야 합니다.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.