
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC12A7 Antibody
상품 한눈에 보기
Human SLC12A7 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. Mouse와 Rat에서도 교차 반응 가능. PrEST 항원을 사용해 친화 정제됨. 40% glycerol, PBS buffer에 보존.
- 카탈로그번호
- HPA041652-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041652-100 Anti-SLC12A7 Antibody, solute carrier family 12 (potassium/chloride transporter), member 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041652-25 Anti-SLC12A7 Antibody, solute carrier family 12 (potassium/chloride transporter), member 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC12A7 Antibody
Anti-SLC12A7 Antibody
Target: solute carrier family 12 (potassium/chloride transporter), member 7
Product Type: Polyclonal Antibody against Human SLC12A7
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody raised in rabbit against human SLC12A7 (solute carrier family 12, potassium/chloride transporter, member 7).
Alternative Gene Names
- DKFZP434F076
- KCC4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 12 (potassium/chloride transporter), member 7 |
| Target Gene | SLC12A7 |
| Antigen Sequence | AARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNV |
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse (84%), Rat (82%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 실험자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



