CacheBy
Atlas Antibodies Anti-SLC12A6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC12A6 Antibody

상품 한눈에 보기

Human SLC12A6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. 고순도 Affinity 정제 방식으로 제조되었으며, 높은 종간 반응 특이성을 보입니다. ACCPN, KCC3 대체 유전자명으로도 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA034563-100 Anti-SLC12A6 Antibody, solute carrier family 12 (potassium/chloride transporter), member 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034563-25 Anti-SLC12A6 Antibody, solute carrier family 12 (potassium/chloride transporter), member 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC12A6 Antibody

Anti-SLC12A6 Antibody

Target: solute carrier family 12 (potassium/chloride transporter), member 6
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SLC12A6.


Alternative Gene Names

  • ACCPN
  • KCC3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 12 (potassium/chloride transporter), member 6
Target Gene SLC12A6
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence RVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDE

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID Sequence Identity
Mouse ENSMUSG00000027130 94%
Rat ENSRNOG00000005196 93%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.