CacheBy
Atlas Antibodies Anti-SLC12A5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC12A5 Antibody

상품 한눈에 보기

Human SLC12A5 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. KCC2로도 알려진 SLC12A5 단백질 연구에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. PBS/glycerol buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA072058-100 Anti-SLC12A5 Antibody, solute carrier family 12 (potassium/chloride transporter), member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA072058-25 Anti-SLC12A5 Antibody, solute carrier family 12 (potassium/chloride transporter), member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC12A5 Antibody

Anti-SLC12A5 Antibody

Target: solute carrier family 12 (potassium/chloride transporter), member 5
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SLC12A5


Alternative Gene Names

  • KCC2
  • KIAA1176

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 12 (potassium/chloride transporter), member 5
Target Gene SLC12A5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSC
Verified Species Reactivity Human
Interspecies Homology Mouse (96%), Rat (81%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.