
Atlas Antibodies Anti-SLC12A4 Antibody
상품 한눈에 보기
인간 SLC12A4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 갖습니다. 40% 글리세롤 PBS 완충액에 보존제로 sodium azide가 포함되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC12A4 Antibody
Target: solute carrier family 12 (potassium/chloride transporter), member 4
Supplier: Atlas Antibodies
Type: Polyclonal Antibody against Human SLC12A4
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human SLC12A4.
Alternative Gene Names
- KCC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Solute carrier family 12 (potassium/chloride transporter), member 4 |
| Target Gene | SLC12A4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (91%), Mouse (89%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC13A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC12A7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC12A4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC12A5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC12A9 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.