Thermo Fisher Scientific 14-3-3 zeta Polyclonal Antibody
14-3-3 zeta 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. WB, IHC, ICC, Flow 등 다양한 응용에 적합. 고순도 항원 친화 크로마토그래피 정제. Lyophilized 형태로 -20°C 보관.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human 14-3-3 zeta/delta sequence (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747359 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
At least seven isoforms comprise the highly conserved 14-3-3 family of homo- and heterodimeric proteins that are abundantly expressed in all eukaryotic cells.
These proteins act as key regulators of signal transduction events mediated through binding to serine-phosphorylated proteins.
By interacting with Cdc25C, 14-3-3 regulates cell cycle entry, and through interaction with Bad, prevents apoptosis.
Other known interacting partners include protein kinase C family members, Cbl, IRS-1, polyoma middle-T antigen, nitrate reductase, S-raf, and the IGF-1 receptor.
Detection of 14-3-3 proteins in cerebrospinal fluid aids in the differential diagnosis of Creutzfeldt-Jakob disease and other prion diseases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific YBX1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific XRCC4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific 14-3-3 zeta Polyclonal Antibody
581,000원
Thermo Fisher Scientific
Thermo Fisher Scientific YBX1 Polyclonal Antibody
581,000원
Thermo Fisher Scientific
Thermo Fisher Scientific YES1 Polyclonal Antibody
581,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|