Thermo Fisher Scientific 14-3-3 zeta Polyclonal Antibody
14-3-3 zeta 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. WB, IHC, ICC, Flow 등 다양한 응용에 적합. 고순도 항원 친화 크로마토그래피 정제. Lyophilized 형태로 -20°C 보관.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific 14-3-3 zeta Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human 14-3-3 zeta/delta sequence (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747359 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
At least seven isoforms comprise the highly conserved 14-3-3 family of homo- and heterodimeric proteins that are abundantly expressed in all eukaryotic cells.
These proteins act as key regulators of signal transduction events mediated through binding to serine-phosphorylated proteins.
By interacting with Cdc25C, 14-3-3 regulates cell cycle entry, and through interaction with Bad, prevents apoptosis.
Other known interacting partners include protein kinase C family members, Cbl, IRS-1, polyoma middle-T antigen, nitrate reductase, S-raf, and the IGF-1 receptor.
Detection of 14-3-3 proteins in cerebrospinal fluid aids in the differential diagnosis of Creutzfeldt-Jakob disease and other prion diseases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.