CacheBy
Thermo Fisher Scientific IRF2 Polyclonal Antibody
원본

Thermo Fisher Scientific IRF2 Polyclonal Antibody

상품 한눈에 보기

IRF2 단백질을 인식하는 Rabbit Polyclonal Antibody로 인간, 생쥐, 랫트에 반응합니다. Western blot에 적합하며 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 08:34
Thermo Fisher Scientific PA579516 IRF2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific IRF2 Polyclonal Antibody

Thermo Fisher Scientific IRF2 Polyclonal Antibody

Applications

  • Western Blot (WB)

Tested Dilution

  • 0.1–0.5 µg/mL

Species Reactivity

  • Human
  • Mouse
  • Rat

Product Specifications

항목 내용
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human IRF2 (317–348aa MTPASSSSRPDRETRASVIKKTSDITQARVKS)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Ambient (domestic); Wet ice (international)
RRID AB_2746632

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

IRF2는 interferon regulatory factor (IRF) 계열에 속하며, 세포 증식 및 면역 반응에 중요한 전사 조절을 담당합니다.
IRF2는 type I IFN 및 IFN-inducible MHC class I 유전자의 상류 조절 영역에 결합하여 해당 유전자의 발현을 억제합니다.
또한 NF-kappa B와의 상호작용을 통해 histone H4의 전사 활성화 인자로도 기능합니다.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

IRF2 Antigen Structure
IRF2 Antigen PDP

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.