Thermo Fisher Scientific IRF2 Polyclonal Antibody
IRF2 단백질을 인식하는 Rabbit Polyclonal Antibody로 인간, 생쥐, 랫트에 반응합니다. Western blot에 적합하며 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific IRF2 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution
- 0.1–0.5 µg/mL
Species Reactivity
- Human
- Mouse
- Rat
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human IRF2 (317–348aa MTPASSSSRPDRETRASVIKKTSDITQARVKS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746632 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
IRF2는 interferon regulatory factor (IRF) 계열에 속하며, 세포 증식 및 면역 반응에 중요한 전사 조절을 담당합니다.
IRF2는 type I IFN 및 IFN-inducible MHC class I 유전자의 상류 조절 영역에 결합하여 해당 유전자의 발현을 억제합니다.
또한 NF-kappa B와의 상호작용을 통해 histone H4의 전사 활성화 인자로도 기능합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CD49a (Integrin alpha 1) Polyclonal Antibody
535,700원
Thermo Fisher Scientific
Thermo Fisher Scientific ISG15 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IRF2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IRF4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IRF5 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|