원본
Thermo Fisher Scientific IRF2 Polyclonal Antibody
상품 한눈에 보기
IRF2 단백질을 인식하는 Rabbit Polyclonal Antibody로 인간, 생쥐, 랫트에 반응합니다. Western blot에 적합하며 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 08:34
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579516 IRF2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific IRF2 Polyclonal Antibody
Thermo Fisher Scientific IRF2 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution
- 0.1–0.5 µg/mL
Species Reactivity
- Human
- Mouse
- Rat
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human IRF2 (317–348aa MTPASSSSRPDRETRASVIKKTSDITQARVKS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746632 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
IRF2는 interferon regulatory factor (IRF) 계열에 속하며, 세포 증식 및 면역 반응에 중요한 전사 조절을 담당합니다.
IRF2는 type I IFN 및 IFN-inducible MHC class I 유전자의 상류 조절 영역에 결합하여 해당 유전자의 발현을 억제합니다.
또한 NF-kappa B와의 상호작용을 통해 histone H4의 전사 활성화 인자로도 기능합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific CD49a (Integrin alpha 1) Polyclonal Antibody535,700원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific ISG15 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific IRF4 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific IRF5 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.