Thermo Fisher Scientific IRF5 Polyclonal Antibody
IRF5 단백질을 표적하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF 등 다양한 응용에 적합. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human IRF5 (442–472aa RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746634 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors involved in virus-mediated activation of interferon and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family have a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative splice variants encoding different isoforms exist.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지: PA5-79518_IRF5_Q13568-1_Rabbit.svg)
(이미지: PA5-79518_IRF5_Q13568-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific IRF2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IRF4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IRF5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IRF9 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IRF7 Polyclonal Antibody
514,100원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|