Atlas Antibodies Anti-EBAG9 Antibody

상품 한눈에 보기

인체 EBAG9 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 독립 검증을 통해 단백질 발현을 확인하였으며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 반응하며, EB9 및 RCAS1 유전자 대체명으로도 알려져 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021153-100 Anti-EBAG9 Antibody, estrogen receptor binding site associated, antigen, 9 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021153-25 Anti-EBAG9 Antibody, estrogen receptor binding site associated, antigen, 9 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

estrogen receptor binding site associated, antigen, 9

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human EBAG9.

EB9, RCAS1

항목	내용
Target Protein	Estrogen receptor binding site associated, antigen, 9
Target Gene	EBAG9
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI

Human

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000022339	99%
Rat	ENSRNOG00000004220	94%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand