CacheBy
Atlas Antibodies Anti-EBF2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EBF2 Antibody

상품 한눈에 보기

Human EBF2 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. Human 반응성이 검증되었으며 Mouse, Rat과 100% 서열 일치. ICC 등 다양한 응용에 적합. 안정한 PBS/glycerol buffer에 보관.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055101-100 Anti-EBF2 Antibody, early B cell factor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055101-25 Anti-EBF2 Antibody, early B cell factor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EBF2 Antibody

Anti-EBF2 Antibody

Target Protein: early B cell factor 2 (EBF2)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human EBF2.

Alternative Gene Names

  • COE2
  • FLJ11500

Open Datasheet (PDF)

Antigen Information

  • Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence: PGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000022053): 100%
  • Rat (ENSRNOG00000011548): 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.