CacheBy
Atlas Antibodies Anti-EARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EARS2 Antibody

상품 한눈에 보기

인간 EARS2 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 특이적으로 반응하며, 보존된 서열로 마우스 및 랫과 81% 동일성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043289-100 Anti-EARS2 Antibody, glutamyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043289-25 Anti-EARS2 Antibody, glutamyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EARS2 Antibody

Anti-EARS2 Antibody

Target Protein: glutamyl-tRNA synthetase 2, mitochondrial
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human EARS2 protein.


Alternative Gene Names

KIAA1970, MSE1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein glutamyl-tRNA synthetase 2, mitochondrial
Target Gene EARS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000030871 (81%), Rat ENSRNOG00000025353 (81%)

Antigen Sequence:
LLDLEKLPEFNRLHLQRLVSNESQRRQLVGKLQVLVEEAFGCQLQNRDVLNPVYVERILLLRQGHICRLQDLVSPVYSYLWTRPAVGRAQ


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.