CacheBy
Atlas Antibodies Anti-EARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EARS2 Antibody

상품 한눈에 보기

인간 EARS2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제됨. 인간 반응성 검증 완료, 40% 글리세롤 및 PBS 버퍼 포함.

카탈로그번호
HPA043633-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043633-100 Anti-EARS2 Antibody, glutamyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043633-25 Anti-EARS2 Antibody, glutamyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EARS2 Antibody

Anti-EARS2 Antibody

Target Protein: glutamyl-tRNA synthetase 2, mitochondrial
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human EARS2 (glutamyl-tRNA synthetase 2, mitochondrial).


Alternative Gene Names

  • KIAA1970
  • MSE1

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
LLDLEKLPEFNRLHLQRLVSNESQRRQLVGKLQVLVEEAFGCQLQNRDVLNPVYVERILLLRQGHICRLQDLVSPVYSYLWTRPAVGRAQ


Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000025353 81%
Mouse ENSMUSG00000030871 81%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Component Description
Buffer PBS (pH 7.2)
Glycerol 40%
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.