AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EARS2 Antibody
상품 한눈에 보기
인간 EARS2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제됨. 인간 반응성 검증 완료, 40% 글리세롤 및 PBS 버퍼 포함.
- 카탈로그번호
- HPA043633-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043633-100 Anti-EARS2 Antibody, glutamyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043633-25 Anti-EARS2 Antibody, glutamyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EARS2 Antibody
Anti-EARS2 Antibody
Target Protein: glutamyl-tRNA synthetase 2, mitochondrial
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human EARS2 (glutamyl-tRNA synthetase 2, mitochondrial).
Alternative Gene Names
- KIAA1970
- MSE1
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
LLDLEKLPEFNRLHLQRLVSNESQRRQLVGKLQVLVEEAFGCQLQNRDVLNPVYVERILLLRQGHICRLQDLVSPVYSYLWTRPAVGRAQ
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000025353 | 81% |
| Mouse | ENSMUSG00000030871 | 81% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Buffer | PBS (pH 7.2) |
| Glycerol | 40% |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.