
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DYRK4 Antibody
상품 한눈에 보기
Human DYRK4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 독립 항체 검증을 통해 신뢰성 있는 단백질 발현 확인 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028065-100 Anti-DYRK4 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028065-25 Anti-DYRK4 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DYRK4 Antibody
Anti-DYRK4 Antibody
Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Recommended Applications
- IHC (Independent validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Validation of protein expression in IHC
Independent antibodies targeting different epitopes of the protein are compared to confirm expression.
Product Description
Polyclonal Antibody against Human DYRK4
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 |
| Target Gene | DYRK4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000030345 (91%), Rat ENSRNOG00000053178 (88%) |
Antigen Sequence:
AELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEP
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



