
Atlas Antibodies Anti-DYRK4 Antibody
상품 한눈에 보기
Human DYRK4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 독립 항체 검증을 통해 신뢰성 있는 단백질 발현 확인 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DYRK4 Antibody
Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Recommended Applications
- IHC (Independent validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Validation of protein expression in IHC
Independent antibodies targeting different epitopes of the protein are compared to confirm expression.
Product Description
Polyclonal Antibody against Human DYRK4
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 |
| Target Gene | DYRK4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000030345 (91%), Rat ENSRNOG00000053178 (88%) |
Antigen Sequence:
AELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEP
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DYRK4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DYRK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DYRK4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DYRK1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DYNLT3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.