Atlas Antibodies Anti-DYRK4 Antibody

상품 한눈에 보기

Human DYRK4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 독립 항체 검증을 통해 신뢰성 있는 단백질 발현 확인 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028065-100 Anti-DYRK4 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028065-25 Anti-DYRK4 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4

Validation of protein expression in IHC
Independent antibodies targeting different epitopes of the protein are compared to confirm expression.

Polyclonal Antibody against Human DYRK4
Open Datasheet

항목	내용
Target Protein	Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Target Gene	DYRK4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000030345 (91%), Rat ENSRNOG00000053178 (88%)

Antigen Sequence:
AELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEP

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand