CacheBy
Atlas Antibodies Anti-DYRK4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DYRK4 Antibody

상품 한눈에 보기

Human DYRK4 단백질을 타깃으로 하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며, 독립 항체 간 비교를 통한 검증 완료. PrEST 항원을 이용해 친화 정제된 고품질 항체로, 인간 DYRK4 단백질 발현 분석에 유용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056073-100 Anti-DYRK4 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056073-25 Anti-DYRK4 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DYRK4 Antibody

Anti-DYRK4 Antibody

Target: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 (DYRK4)
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human DYRK4.
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Target Gene DYRK4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEP

Species Reactivity

항목 내용
Verified Reactivity Human
Ortholog Identity Mouse ENSMUSG00000030345 (91%), Rat ENSRNOG00000053178 (88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Validation
Independent Validation
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.