Atlas Antibodies Anti-DYNLT3 Antibody

상품 한눈에 보기

Human DYNLT3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, RNA-seq 데이터 기반 정교한 Orthogonal 검증 완료. 고순도 Affinity 정제 및 안정한 보존용액 구성.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA003938-100 Anti-DYNLT3 Antibody, dynein, light chain, Tctex-type 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA003938-25 Anti-DYNLT3 Antibody, dynein, light chain, Tctex-type 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: dynein, light chain, Tctex-type 3
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Polyclonal antibody against Human DYNLT3.

항목	내용
Target Protein	dynein, light chain, Tctex-type 3
Target Gene	DYNLT3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWE
Verified Species Reactivity	Human, Rat
Interspecies Identity	Mouse ENSMUSG00000031176 (92%), Rat ENSRNOG00000003611 (89%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)