CacheBy
Atlas Antibodies Anti-DYRK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DYRK2 Antibody

상품 한눈에 보기

Human DYRK2 단백질을 인식하는 토끼 폴리클로날 항체로, PrEST 항원을 이용해 친화정제됨. 면역세포화학(ICC) 등 다양한 응용에 적합하며, 인체 DYRK2 단백질에 특이적 반응을 보임. 40% glycerol 기반 PBS 버퍼에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027230-100 Anti-DYRK2 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027230-25 Anti-DYRK2 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DYRK2 Antibody

Anti-DYRK2 Antibody

Target: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 (DYRK2)

면역세포화학(ICC) 등 다양한 연구용 응용에 사용 가능.

Product Description

Polyclonal antibody against human DYRK2.
Open Datasheet

Target Information

  • Target Protein: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
  • Target Gene: DYRK2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000007821 98%
Mouse ENSMUSG00000028630 98%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.