
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DYRK2 Antibody
상품 한눈에 보기
인간 DYRK2 단백질을 표적으로 하는 토끼 폴리클로날 항체. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 특이적이며 마우스 및 랫과 98% 서열 유사성. 안정적 PBS-글리세롤 버퍼에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056902-100 Anti-DYRK2 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056902-25 Anti-DYRK2 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DYRK2 Antibody
Anti-DYRK2 Antibody
Target: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 (DYRK2)
Type: Polyclonal Antibody against Human DYRK2
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human DYRK2.
Affinity purified using the PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 |
| Target Gene | DYRK2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000028630 (98%), Rat ENSRNOG00000007821 (98%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



