CacheBy
Atlas Antibodies Anti-DYRK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DYRK2 Antibody

상품 한눈에 보기

인간 DYRK2 단백질을 표적으로 하는 토끼 폴리클로날 항체. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 특이적이며 마우스 및 랫과 98% 서열 유사성. 안정적 PBS-글리세롤 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056902-100 Anti-DYRK2 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056902-25 Anti-DYRK2 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DYRK2 Antibody

Anti-DYRK2 Antibody

Target: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 (DYRK2)
Type: Polyclonal Antibody against Human DYRK2


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human DYRK2.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
Target Gene DYRK2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLP
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000028630 (98%), Rat ENSRNOG00000007821 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.