
Atlas Antibodies Anti-DYRK3 Antibody
상품 한눈에 보기
Human DYRK3 단백질을 인식하는 토끼 유래 폴리클로날 항체로, PrEST 항원을 이용해 친화 정제됨. ICC 등 다양한 응용에 적합하며, 40% 글리세롤 PBS 버퍼에 보존. 인간에 대해 검증되었으며, 설치류와 높은 서열 유사성을 가짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DYRK3 Antibody
Target: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 (DYRK3)
Type: Polyclonal Antibody against Human DYRK3
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human DYRK3 protein.
Purified by affinity chromatography using the PrEST antigen as ligand.
Alternative Gene Names
hYAK3-2, RED, REDK
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 |
| Target Gene | DYRK3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQ |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000004870 (75%), Mouse ENSMUSG00000016526 (74%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DYRK1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DYNLT3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DYRK3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DYRK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DYNLL1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.