CacheBy
Atlas Antibodies Anti-DYRK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DYRK3 Antibody

상품 한눈에 보기

Human DYRK3 단백질을 인식하는 토끼 유래 폴리클로날 항체로, PrEST 항원을 이용해 친화 정제됨. ICC 등 다양한 응용에 적합하며, 40% 글리세롤 PBS 버퍼에 보존. 인간에 대해 검증되었으며, 설치류와 높은 서열 유사성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA075041-100 Anti-DYRK3 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075041-25 Anti-DYRK3 Antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DYRK3 Antibody

Anti-DYRK3 Antibody

Target: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 (DYRK3)
Type: Polyclonal Antibody against Human DYRK3


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human DYRK3 protein.
Purified by affinity chromatography using the PrEST antigen as ligand.


Alternative Gene Names

hYAK3-2, RED, REDK

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
Target Gene DYRK3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQ
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004870 (75%), Mouse ENSMUSG00000016526 (74%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.