AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SEC13 Antibody
상품 한눈에 보기
인간 SEC13 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 반응성(마우스·랫 97%)을 보입니다. 안정적인 PBS/glycerol buffer에 보존되어 있습니다.
- 카탈로그번호
- HPA057943-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057943-100 Anti-SEC13 Antibody, SEC13 homolog, nuclear pore and COPII coat complex component 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057943-25 Anti-SEC13 Antibody, SEC13 homolog, nuclear pore and COPII coat complex component 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SEC13 Antibody
Anti-SEC13 Antibody
Target Information
- Target Protein: SEC13 homolog (S. cerevisiae)
- Target Gene: SEC13
- Alternative Gene Names: D3S1231E, npp-20, SEC13L1, SEC13R
Product Description
Polyclonal antibody against human SEC13.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDV
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000030298 (97%)
- Rat ENSRNOG00000010628 (97%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.