CacheBy
Atlas Antibodies Anti-SEC11C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SEC11C Antibody

상품 한눈에 보기

Human SEC11C 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. SEC11L3/SPC21/SPCS4C 등의 대체 유전자명과 교차 반응 정보 제공.

카탈로그번호
HPA026816-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026816-100 Anti-SEC11C Antibody, SEC11 homolog C (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026816-25 Anti-SEC11C Antibody, SEC11 homolog C (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEC11C Antibody

Anti-SEC11C Antibody

SEC11 homolog C (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human SEC11C

Alternative Gene Names

SEC11L3, SPC21, SPCS4C

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein SEC11 homolog C (S. cerevisiae)
Target Gene SEC11C
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000017036 (88%), Mouse ENSMUSG00000024516 (88%)

Antigen Sequence:
MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.