Atlas Antibodies Anti-SEC14L1 Antibody

상품 한눈에 보기

Human SEC14L1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공. SEC14L1 및 관련 단백질 연구용으로 권장.

카탈로그번호: HPA028703-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028703-100 Anti-SEC14L1 Antibody, SEC14-like 1 (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028703-25 Anti-SEC14L1 Antibody, SEC14-like 1 (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SEC14L1 Antibody

Anti-SEC14L1 Antibody

Target Information

Target Protein: SEC14-like 1 (S. cerevisiae)
Target Gene: SEC14L1
Alternative Gene Names: PRELID4A, SEC14L

Product Description

Polyclonal antibody against human SEC14L1 protein, designed for research use. The antibody is affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPRWSPPSITPSSETSSSSSKKQAASMAVVIPEAALKEGLSGDALSSPSAPEPVVGTPDD

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

Rat ENSRNOG00000002722 (78%)
Mouse ENSMUSG00000020823 (73%)

Recommended Applications

Immunohistochemistry (IHC)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage	Gently mix before use. Store according to manufacturer’s recommendations.
MSDS	Material Safety Data Sheet