CacheBy
Atlas Antibodies Anti-SEC13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SEC13 Antibody

상품 한눈에 보기

인간 SEC13 단백질을 인식하는 고품질 폴리클로날 항체. Rabbit에서 생산된 IgG 아이소타입으로 IHC 및 WB에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 보장. Human, Rat, Mouse 반응성 확인됨.

카탈로그번호
HPA035292-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035292-100 Anti-SEC13 Antibody, SEC13 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035292-25 Anti-SEC13 Antibody, SEC13 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEC13 Antibody

Anti-SEC13 Antibody

Target Information

  • Target Protein: SEC13 homolog (S. cerevisiae)
  • Target Gene: SEC13
  • Alternative Gene Names: D3S1231E, npp-20, SEC13L1, SEC13R
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human SEC13.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000010628 97%
Mouse ENSMUSG00000030298 97%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.