CacheBy
Atlas Antibodies Anti-SEC13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SEC13 Antibody

상품 한눈에 보기

인간 SEC13 단백질을 인식하는 고품질 폴리클로날 항체. Rabbit에서 생산된 IgG 아이소타입으로 IHC 및 WB에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 보장. Human, Rat, Mouse 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035292-100 Anti-SEC13 Antibody, SEC13 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035292-25 Anti-SEC13 Antibody, SEC13 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEC13 Antibody

Anti-SEC13 Antibody

Target Information

  • Target Protein: SEC13 homolog (S. cerevisiae)
  • Target Gene: SEC13
  • Alternative Gene Names: D3S1231E, npp-20, SEC13L1, SEC13R
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human SEC13.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000010628 97%
Mouse ENSMUSG00000030298 97%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.