CacheBy
Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC
원본

Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC

상품 한눈에 보기

Adenine Nucleotide Translocator 2(ANT2)에 특이적인 FITC 결합 토끼 폴리클로날 항체. Western blot, IHC, ICC, ELISA 등 다양한 응용에 적합. 인간, 생쥐, 랫트 반응성. 형광 검출용으로 498/517 nm에서 발광. 연구용으로만 사용 가능.

카탈로그번호
ANT2-FITC
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 05:11
Thermo Fisher Scientific ANT2-FITC Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC 200 ul pk판매 단위 pk ·
재고 확인 필요
594,400원VAT 포함 653,840원

Thermo Fisher Scientific · Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC

Applications and Tested Dilutions

Application Tested Dilution
Western Blot (WB) 1:500–1:1,000
Immunohistochemistry (IHC) 1:50–1:250
Immunocytochemistry (ICC/IF) 1:50–1:250
ELISA 1:10,000
Immunoprecipitation (IP) 1:50–1:250
Immunomicroscopy (IM) 1:50–1:200

Product Specifications

Specification Description
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide within amino acid region 150–200 of human ADP/ATP translocase 2 (Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK)
Conjugate FITC (Fluorescein)
Excitation / Emission Max 498 / 517 nm
Form Liquid
Concentration 0.5–1.5 mg/mL
Purification Affinity chromatography
Storage Buffer Proprietary buffer, pH 7.4–7.8, with 0.5% BSA, 30% glycerol
Contains 0.02% sodium azide
Storage Conditions −20 °C, store in dark
Shipping Conditions Ambient (domestic); Wet ice (international)

Target Information

Adenine nucleotide translocator (ANT)와 voltage-dependent anion-selective channel proteins (VDAC1, VDAC2)은 미토콘드리아 내외막의 투과성 전이공 복합체(PTPC)의 구성 요소입니다. PTPC 형성, 미토콘드리아 막전위 소실, 그리고 시토크롬 c 방출은 세포자멸사(apoptosis)의 초기 단계에서 중요한 역할을 합니다. Bax 단백질은 ANT에 작용하여 막전위 소실을 유도합니다. ANT1은 미토콘드리아 DNA 유지와 ATP/ADP 교환에 관여합니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

spectra

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.