Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC
Adenine Nucleotide Translocator 2(ANT2)에 특이적인 FITC 결합 토끼 폴리클로날 항체. Western blot, IHC, ICC, ELISA 등 다양한 응용에 적합. 인간, 생쥐, 랫트 반응성. 형광 검출용으로 498/517 nm에서 발광. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (IHC) | 1:50–1:250 |
| Immunocytochemistry (ICC/IF) | 1:50–1:250 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:50–1:250 |
| Immunomicroscopy (IM) | 1:50–1:200 |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide within amino acid region 150–200 of human ADP/ATP translocase 2 (Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK) |
| Conjugate | FITC (Fluorescein) |
| Excitation / Emission Max | 498 / 517 nm |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer, pH 7.4–7.8, with 0.5% BSA, 30% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | −20 °C, store in dark |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
Adenine nucleotide translocator (ANT)와 voltage-dependent anion-selective channel proteins (VDAC1, VDAC2)은 미토콘드리아 내외막의 투과성 전이공 복합체(PTPC)의 구성 요소입니다. PTPC 형성, 미토콘드리아 막전위 소실, 그리고 시토크롬 c 방출은 세포자멸사(apoptosis)의 초기 단계에서 중요한 역할을 합니다. Bax 단백질은 ANT에 작용하여 막전위 소실을 유도합니다. ANT1은 미토콘드리아 DNA 유지와 ATP/ADP 교환에 관여합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Na+/H+ Exchanger 5 (NHE-5) Polyclonal Antibody
742,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Na+/H+ Exchanger 2 (NHE-2) Polyclonal Antibody
742,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC
594,400원
Thermo Fisher Scientific
Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, Biotin
594,400원
Thermo Fisher Scientific
Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody
449,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|