원본

Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC

상품 한눈에 보기

Adenine Nucleotide Translocator 2(ANT2)에 특이적인 FITC 결합 토끼 폴리클로날 항체. Western blot, IHC, ICC, ELISA 등 다양한 응용에 적합. 인간, 생쥐, 랫트 반응성. 형광 검출용으로 498/517 nm에서 발광. 연구용으로만 사용 가능.

브랜드: Thermo Fisher Scientific
카테고리: Polyclonal Antibodies
판매단위: pk

카탈로그

1개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

ADBIX 2026 전시회10/28~30 코엑스 · 사전등록 안내자세히보기

Thermo Fisher Scientific ANT2-FITC Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC 200 ul pk판매 단위 pk

재고 확인 필요

594,400원VAT 포함 653,840원

실재고는 공급사 재고를 그 자리에서 확인합니다 · 확인된 값은 페이지를 벗어날 때까지 유지됩니다

Thermo Fisher Scientific · Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC

Applications and Tested Dilutions

Application	Tested Dilution
Western Blot (WB)	1:500–1:1,000
Immunohistochemistry (IHC)	1:50–1:250
Immunocytochemistry (ICC/IF)	1:50–1:250
ELISA	1:10,000
Immunoprecipitation (IP)	1:50–1:250
Immunomicroscopy (IM)	1:50–1:200

Product Specifications

Specification	Description
Species Reactivity	Human, Mouse, Rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	Synthetic peptide within amino acid region 150–200 of human ADP/ATP translocase 2 (Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK)
Conjugate	FITC (Fluorescein)
Excitation / Emission Max	498 / 517 nm
Form	Liquid
Concentration	0.5–1.5 mg/mL
Purification	Affinity chromatography
Storage Buffer	Proprietary buffer, pH 7.4–7.8, with 0.5% BSA, 30% glycerol
Contains	0.02% sodium azide
Storage Conditions	−20 °C, store in dark
Shipping Conditions	Ambient (domestic); Wet ice (international)

Target Information

Adenine nucleotide translocator (ANT)와 voltage-dependent anion-selective channel proteins (VDAC1, VDAC2)은 미토콘드리아 내외막의 투과성 전이공 복합체(PTPC)의 구성 요소입니다. PTPC 형성, 미토콘드리아 막전위 소실, 그리고 시토크롬 c 방출은 세포자멸사(apoptosis)의 초기 단계에서 중요한 역할을 합니다. Bax 단백질은 ANT에 작용하여 막전위 소실을 유도합니다. ANT1은 미토콘드리아 DNA 유지와 ATP/ADP 교환에 관여합니다.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

spectra

Thermo Fisher Scientific 상품 둘러보기

전체보기

Thermo Fisher ScientificThermo Fisher Scientific Na+/H+ Exchanger 5 (NHE-5) Polyclonal Antibody742,000원VAT별도

Thermo Fisher ScientificThermo Fisher Scientific Na+/H+ Exchanger 2 (NHE-2) Polyclonal Antibody742,000원VAT별도

Thermo Fisher ScientificThermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, Biotin594,400원VAT별도

Thermo Fisher ScientificThermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody449,700원VAT별도

문의

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.