원본
Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC
상품 한눈에 보기
Adenine Nucleotide Translocator 2(ANT2)에 특이적인 FITC 결합 토끼 폴리클로날 항체. Western blot, IHC, ICC, ELISA 등 다양한 응용에 적합. 인간, 생쥐, 랫트 반응성. 형광 검출용으로 498/517 nm에서 발광. 연구용으로만 사용 가능.
- 카탈로그번호
- ANT2-FITC
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 05:11
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific ANT2-FITC Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC 200 ul pk판매 단위 pk ·
재고 확인 필요
594,400원VAT 포함 653,840원
Thermo Fisher Scientific · Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (IHC) | 1:50–1:250 |
| Immunocytochemistry (ICC/IF) | 1:50–1:250 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:50–1:250 |
| Immunomicroscopy (IM) | 1:50–1:200 |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide within amino acid region 150–200 of human ADP/ATP translocase 2 (Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK) |
| Conjugate | FITC (Fluorescein) |
| Excitation / Emission Max | 498 / 517 nm |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer, pH 7.4–7.8, with 0.5% BSA, 30% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | −20 °C, store in dark |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
Adenine nucleotide translocator (ANT)와 voltage-dependent anion-selective channel proteins (VDAC1, VDAC2)은 미토콘드리아 내외막의 투과성 전이공 복합체(PTPC)의 구성 요소입니다. PTPC 형성, 미토콘드리아 막전위 소실, 그리고 시토크롬 c 방출은 세포자멸사(apoptosis)의 초기 단계에서 중요한 역할을 합니다. Bax 단백질은 ANT에 작용하여 막전위 소실을 유도합니다. ANT1은 미토콘드리아 DNA 유지와 ATP/ADP 교환에 관여합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Na+/H+ Exchanger 5 (NHE-5) Polyclonal Antibody742,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Na+/H+ Exchanger 2 (NHE-2) Polyclonal Antibody742,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, Biotin594,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody449,700원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.