원본
Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody
상품 한눈에 보기
Adenine Nucleotide Translocator 2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC, ELISA, IP 등 다양한 응용에 적합. Human, Mouse, Rat 반응성. Affinity chromatography로 정제되었으며, -20°C 보관.
- 카탈로그번호
- ANT2-201AP
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 06:35
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific ANT2-201AP Adenine Nucleotide Translocator 2 Polyclonal Antibody 200 ul pk판매 단위 pk ·
재고 확인 필요
449,700원VAT 포함 494,670원
Thermo Fisher Scientific · Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (IHC) | 1:50–1:250 |
| Immunocytochemistry (ICC/IF) | 1:50–1:250 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:50–1:250 |
| Immunomicroscopy (IM) | 1:50–1:200 |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide within amino acid region 150–200 of human ADP/ATP translocase 2. Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer, pH 7.4–7.8, with 0.5% BSA, 30% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
Adenine nucleotide translocator (ANT)와 voltage-dependent anion-selective channel proteins (VDAC1, VDAC2)는 각각 미토콘드리아 내막과 외막의 permeability transition pore complex (PTPC)를 구성합니다.
PTPC 형성, 미토콘드리아 내막 전위 소실, 그리고 cytochrome c 방출은 세포사 초기 단계의 핵심 과정입니다.
Bax 단백질은 ANT에 작용하여 미토콘드리아 내막 전위를 소실시키며, ANT1은 ADP와 ATP 교환을 촉매하여 미토콘드리아 DNA 유지에 관여합니다.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC594,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, Biotin594,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SLC11A1/NRAMP1 (extracellular) Polyclonal Antibody, FITC807,500원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SLC11A1/NRAMP1 (extracellular) Polyclonal Antibody742,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.