원본
Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, Biotin
상품 한눈에 보기
Thermo Fisher Scientific의 Adenine Nucleotide Translocator 2 Polyclonal Antibody, Biotin은 인간, 마우스, 랫트에 반응하는 rabbit IgG 항체입니다. 다양한 응용(WB, IHC, ICC, ELISA 등)에 사용 가능하며, Biotin 결합형으로 높은 특이성과 감도를 제공합니다. 연구용으로만 사용됩니다.
- 카탈로그번호
- ANT2-BIOTIN
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 08:24
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific ANT2-BIOTIN Adenine Nucleotide Translocator 2 Polyclonal Antibody, Biotin 200 ul pk판매 단위 pk ·
재고 확인 필요
594,400원VAT 포함 653,840원
Thermo Fisher Scientific · Thermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, Biotin
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (IHC) | 1:50–1:250 |
| Immunocytochemistry (ICC/IF) | 1:50–1:250 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:50–1:250 |
| Immunomicroscopy (IM) | 1:50–1:200 |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide within amino acid region 150–200 of human ADP/ATP translocase 2 (Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK) |
| Conjugate | Biotin |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer, pH 7.4–7.8, with 30% glycerol, 0.5% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
Adenine nucleotide translocator (ANT)와 voltage-dependent anion-selective channel proteins (VDAC1, VDAC2)은 미토콘드리아 내외막의 permeability transition pore complex (PTPC)의 구성 요소입니다. PTPC 형성, 미토콘드리아 내막 전위 소실, 그리고 cytochrome c 방출은 apoptosis 초기 단계의 핵심 과정입니다. Bax 단백질은 ANT를 통해 미토콘드리아 내막 전위 소실을 유도하며, ANT1은 ADP와 ATP 교환을 촉매하여 미토콘드리아 DNA 유지에 관여합니다.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Na+/H+ Exchanger 2 (NHE-2) Polyclonal Antibody742,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody, FITC594,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Adenine Nucleotide Translocator 2 Polyclonal Antibody449,700원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SLC11A1/NRAMP1 (extracellular) Polyclonal Antibody, FITC807,500원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.