
Atlas Antibodies Anti-DPH3 Antibody
상품 한눈에 보기
Human DPH3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, Human에 대한 검증 완료. Diphthamide biosynthesis 연구에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DPH3 Antibody
Target Information
- Target Protein: diphthamide biosynthesis 3
- Target Gene: DPH3
- Alternative Gene Names: DELGIP, DELGIP1, DESR1, DPH3A, KTI11, MGC20197, ZCSL2
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human DPH3, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000021905 | 96% |
| Rat | ENSRNOG00000019727 | 94% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Preservative | 0.02% sodium azide (Material Safety Data Sheet) |
Notes
- 사용 전 충분히 혼합하십시오.
- 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
