CacheBy
Atlas Antibodies Anti-DPH3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DPH3 Antibody

상품 한눈에 보기

Human DPH3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, Human에 대한 검증 완료. Diphthamide biosynthesis 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035287-100 Anti-DPH3 Antibody, diphthamide biosynthesis 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035287-25 Anti-DPH3 Antibody, diphthamide biosynthesis 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DPH3 Antibody

Anti-DPH3 Antibody

Target Information

  • Target Protein: diphthamide biosynthesis 3
  • Target Gene: DPH3
  • Alternative Gene Names: DELGIP, DELGIP1, DESR1, DPH3A, KTI11, MGC20197, ZCSL2
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human DPH3, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000021905 96%
Rat ENSRNOG00000019727 94%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Glycerol 40%
PBS pH 7.2
Preservative 0.02% sodium azide (Material Safety Data Sheet)

Notes

  • 사용 전 충분히 혼합하십시오.
  • 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.

Reference

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.