
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DPH3 Antibody
상품 한눈에 보기
Human DPH3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, Human에 대한 검증 완료. Diphthamide biosynthesis 연구에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035287-100 Anti-DPH3 Antibody, diphthamide biosynthesis 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035287-25 Anti-DPH3 Antibody, diphthamide biosynthesis 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DPH3 Antibody
Anti-DPH3 Antibody
Target Information
- Target Protein: diphthamide biosynthesis 3
- Target Gene: DPH3
- Alternative Gene Names: DELGIP, DELGIP1, DESR1, DPH3A, KTI11, MGC20197, ZCSL2
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human DPH3, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
EDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVK
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000021905 | 96% |
| Rat | ENSRNOG00000019727 | 94% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Preservative | 0.02% sodium azide (Material Safety Data Sheet) |
Notes
- 사용 전 충분히 혼합하십시오.
- 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



