
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DPH7 Antibody
상품 한눈에 보기
Human DPH7 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 실험에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. DPH7 관련 연구 및 diphthamide 생합성 경로 분석에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA022911-100 Anti-DPH7 Antibody, diphthamide biosynthesis 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022911-25 Anti-DPH7 Antibody, diphthamide biosynthesis 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DPH7 Antibody
Anti-DPH7 Antibody
Target Information
- Target Protein: diphthamide biosynthesis 7
- Target Gene: DPH7
- Alternative Gene Names: C9orf112, FLJ90634, RRT2, WDR85
Product Description
Polyclonal antibody against Human DPH7.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
WSWLLFRSLQRAPSWSFPSNLGTKTADLKGASELPTPCHECREDNDGEGHARPQSGMKPLTEGMRKNGTWLQATAATTRDCGVNPEEADSA
Species Reactivity
- Verified Species: Human
- Interspecies Information:
- Rat (ENSRNOG00000008102) – 34% identity
- Mouse (ENSMUSG00000091002) – 24% identity
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도와 조건은 사용자가 실험 목적에 따라 결정해야 합니다.
- Open Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



