Atlas Antibodies Anti-DPM2 Antibody
상품 한눈에 보기
Human DPM2 단백질을 인식하는 rabbit polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, glycerol/PBS buffer에 보존제 포함. 최적 조건은 사용자가 실험에 따라 조정 필요.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DPM2 Antibody
Target: dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Type: Polyclonal Antibody against Human DPM2
Recommended Applications
IHC (Immunohistochemistry)
Product Description
Rabbit polyclonal antibody targeting the human DPM2 protein (dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit).
Alternative Gene Names
- MGC111193
- MGC21559
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit |
| Target Gene | DPM2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SSPPPLDPGQGFGKTPPLNMLPHFGGAGSCLPRTHPWGFPVHPSRLPVSNLWVSWC |
| Verified Species Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000020426 (38%), Mouse ENSMUSG00000040857 (38%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.