Atlas Antibodies Anti-DPM2 Antibody

상품 한눈에 보기

Human DPM2 단백질을 인식하는 rabbit polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, glycerol/PBS buffer에 보존제 포함. 최적 조건은 사용자가 실험에 따라 조정 필요.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA064623-100 Anti-DPM2 Antibody, dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA064623-25 Anti-DPM2 Antibody, dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-DPM2 Antibody

Anti-DPM2 Antibody

Target: dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Type: Polyclonal Antibody against Human DPM2

Recommended Applications

IHC (Immunohistochemistry)

Product Description

Rabbit polyclonal antibody targeting the human DPM2 protein (dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit).

Alternative Gene Names

MGC111193
MGC21559

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Target Gene	DPM2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SSPPPLDPGQGFGKTPPLNMLPHFGGAGSCLPRTHPWGFPVHPSRLPVSNLWVSWC
Verified Species Reactivity	Human
Ortholog Identity	Rat ENSRNOG00000020426 (38%), Mouse ENSMUSG00000040857 (38%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)