CacheBy
Atlas Antibodies Anti-DPH5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DPH5 Antibody

상품 한눈에 보기

인간 DPH5 단백질을 인식하는 폴리클로날 항체입니다. Rabbit에서 생산된 IgG 형 항체로, diphthamide biosynthesis 연구에 적합합니다. PrEST 항원으로 친화 정제되었으며, Human에 대한 반응성이 검증되었습니다. IHC 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046439-100 Anti-DPH5 Antibody, diphthamide biosynthesis 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046439-25 Anti-DPH5 Antibody, diphthamide biosynthesis 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DPH5 Antibody

Anti-DPH5 Antibody

Target: diphthamide biosynthesis 5 (DPH5)
Supplier: Atlas Antibodies

면역조직화학(IHC)

Product Description

Polyclonal Antibody against Human DPH5

Alternative Gene Names

  • CGI-30

Open Datasheet

Target Information

항목 내용
Target Protein diphthamide biosynthesis 5
Target Gene DPH5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000033554 (80%), Rat ENSRNOG00000013719 (79%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

SVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGADDQKIAAGTLRQMCTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQSING

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Safety Information

Material Safety Data Sheet (MSDS)

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.