
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SASH3 Antibody
상품 한눈에 보기
Human SASH3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증된 고품질 항체로, RNA-seq 데이터와 재조합 발현을 통한 orthogonal validation 완료. PrEST 항원을 이용한 친화 정제 방식 적용.
- 카탈로그번호
- HPA001085-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001085-100 Anti-SASH3 Antibody, SAM and SH3 domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001085-25 Anti-SASH3 Antibody, SAM and SH3 domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SASH3 Antibody
Anti-SASH3 Antibody
Target: SAM and SH3 domain containing 3 (SASH3)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고발현 및 저발현 조직에서 교차 검증
- WB (Recombinant Expression Validation): 재조합 단백질 과발현 샘플을 이용한 Western blot 검증
Product Description
Polyclonal antibody against human SASH3 (SAM and SH3 domain containing 3).
Alternative Gene Names
753P9, CXorf9, HACS2, SH3D6C, SLY
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | SAM and SH3 domain containing 3 |
| Target Gene | SASH3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSL |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (99%), Rat (97%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



