
Atlas Antibodies Anti-SASH3 Antibody
상품 한눈에 보기
Human SASH3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증된 고품질 항체로, RNA-seq 데이터와 재조합 발현을 통한 orthogonal validation 완료. PrEST 항원을 이용한 친화 정제 방식 적용.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SASH3 Antibody
Target: SAM and SH3 domain containing 3 (SASH3)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고발현 및 저발현 조직에서 교차 검증
- WB (Recombinant Expression Validation): 재조합 단백질 과발현 샘플을 이용한 Western blot 검증
Product Description
Polyclonal antibody against human SASH3 (SAM and SH3 domain containing 3).
Alternative Gene Names
753P9, CXorf9, HACS2, SH3D6C, SLY
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | SAM and SH3 domain containing 3 |
| Target Gene | SASH3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSL |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (99%), Rat (97%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SASH1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SARS2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SASH3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SART3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SART1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.