CacheBy
Atlas Antibodies Anti-SASH3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SASH3 Antibody

상품 한눈에 보기

Human SASH3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증된 고품질 항체로, RNA-seq 데이터와 재조합 발현을 통한 orthogonal validation 완료. PrEST 항원을 이용한 친화 정제 방식 적용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA001085-100 Anti-SASH3 Antibody, SAM and SH3 domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001085-25 Anti-SASH3 Antibody, SAM and SH3 domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SASH3 Antibody

Anti-SASH3 Antibody

Target: SAM and SH3 domain containing 3 (SASH3)
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고발현 및 저발현 조직에서 교차 검증
  • WB (Recombinant Expression Validation): 재조합 단백질 과발현 샘플을 이용한 Western blot 검증

Product Description

Polyclonal antibody against human SASH3 (SAM and SH3 domain containing 3).


Alternative Gene Names

753P9, CXorf9, HACS2, SH3D6C, SLY

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein SAM and SH3 domain containing 3
Target Gene SASH3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSL
Verified Species Reactivity Human
Interspecies Homology Mouse (99%), Rat (97%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB Recombinant Expression
Recombinant Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.