CacheBy
Atlas Antibodies Anti-SASH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SASH1 Antibody

상품 한눈에 보기

Human SASH1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 검증되었으며 Mouse, Rat과의 교차 반응성이 보고되었습니다.

카탈로그번호
HPA029949-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029949-100 Anti-SASH1 Antibody, SAM and SH3 domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029949-25 Anti-SASH1 Antibody, SAM and SH3 domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SASH1 Antibody

Anti-SASH1 Antibody

Target: SAM and SH3 domain containing 1 (SASH1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SASH1.


Alternative Gene Names

dJ323M4.1, KIAA0790, SH3D6A

Open Datasheet


Target Information

항목 내용
Target Protein SAM and SH3 domain containing 1
Target Gene SASH1
Verified Species Reactivity Human
Interspecies Identity Mouse (78%), Rat (76%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LLSAKSSTEPSLKSFSRNQLGNYPTLPLMKSGDALKQGQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCETLEGPQTVDTWPRSH

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.