CacheBy
Atlas Antibodies Anti-SARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SARS2 Antibody

상품 한눈에 보기

Human SARS2 단백질을 인식하는 토끼 폴리클로날 항체로, seryl-tRNA synthetase 2, mitochondrial을 타깃으로 함. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 응용에 적합. PBS 및 글리세롤 완충액에 보존제 포함.

카탈로그번호
HPA056957-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056957-100 Anti-SARS2 Antibody, seryl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056957-25 Anti-SARS2 Antibody, seryl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SARS2 Antibody

Anti-SARS2 Antibody

Target: seryl-tRNA synthetase 2, mitochondrial (SARS2)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG


Immunohistochemistry (IHC)


Product Description

Polyclonal antibody against human SARS2 protein.


Alternative Gene Names

FLJ20450, mtSerRS, SARS, SARSM, SerRSmt, SERS, SYS

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein seryl-tRNA synthetase 2, mitochondrial
Target Gene SARS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGL
Verified Species Reactivity Human
Interspecies Identity Mouse (91%), Rat (89%)

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.