Atlas Antibodies Anti-SART3 Antibody

상품 한눈에 보기

Human SART3 단백질을 인식하는 고품질 Rabbit Polyclonal Antibody. WB 및 ICC에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성을 가지며, 연구용으로 최적화된 제품.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028840-100 Anti-SART3 Antibody, squamous cell carcinoma antigen recognized by T cells 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028840-25 Anti-SART3 Antibody, squamous cell carcinoma antigen recognized by T cells 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Squamous cell carcinoma antigen recognized by T cells 3 (SART3)
Supplier: Atlas Antibodies

Polyclonal antibody against human SART3.

KIAA0156, p110, RP11-13G14, TIP110

항목	내용
Target Protein	Squamous cell carcinoma antigen recognized by T cells 3
Target Gene	SART3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000000702 (94%), Mouse ENSMUSG00000018974 (92%)

Antigen Sequence:
LSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGL

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Data Sheet	Material Safety Data Sheet