CacheBy
Atlas Antibodies Anti-SART3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SART3 Antibody

상품 한눈에 보기

Human SART3 단백질을 인식하는 고품질 Rabbit Polyclonal Antibody. WB 및 ICC에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성을 가지며, 연구용으로 최적화된 제품.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA028840-100 Anti-SART3 Antibody, squamous cell carcinoma antigen recognized by T cells 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028840-25 Anti-SART3 Antibody, squamous cell carcinoma antigen recognized by T cells 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SART3 Antibody

Anti-SART3 Antibody

Target: Squamous cell carcinoma antigen recognized by T cells 3 (SART3)
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SART3.


Alternative Gene Names

KIAA0156, p110, RP11-13G14, TIP110

Open Datasheet


Target Information

항목 내용
Target Protein Squamous cell carcinoma antigen recognized by T cells 3
Target Gene SART3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000000702 (94%), Mouse ENSMUSG00000018974 (92%)

Antigen Sequence:
LSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGL


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

WB Recommended Application
ICC Recommended Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.